seo site checkup logo
PricingFree ToolsArticles
Log in
Report generated 16 minutes ago
https://awgrammar.com
Your general SEO Checkup Score
Archived
86/100
SEO Score
8 Failed
1 Warnings
58 Passed
Issues to fix
Last found on May 20 2022, 04:13 AM
HIGH
Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
HIGH
This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
HIGH
Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
MEDIUM
The Document Object Model (DOM) of this webpage has 1,599 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
MEDIUM
A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
MEDIUM
Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
LOW
Your webpage is using inline CSS styles!
Common SEO issues
5Failed
0Warnings
21Passed
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Awgrammars - grammar
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
grammar
Google Search Results Preview Test
Awgrammars - grammarhttps://awgrammar.comgrammar
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Awgrammars
og:description
grammar
og:url
https://awgrammar.com/
og:site_name
Awgrammars
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
19hindi11hain10read10categories10grammar
Keywords Usage Test81% of top 100 sites passed
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
akarmakalphabetawgrammarawgrammarsbhedbuiltcategoriescommentcommentscontactcontentdisclaimergeneratepressgrammarhainhindihomehotekaalkahatekahtekarakkisekitnekriyaleavelettersmenunavigationnijvachakolderpageparibhashapolicypostpostsprakarprivacyreadrecentsakarmaksanyuktsarvanamsearchshabdskiptagsupsargvarnamalaउपसररमबदसमझन
Competitor Domains Test
Understand your competitors' SEO profile

Side-by-side SEO comparisons of up to 5 competitors. See how your SEO can improve against the competition.

Heading Tags Test70% of top 100 sites passed
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Shabd ki Paribhasha , शब्द क्या हैं इनके भेदों के व्याख्या एवं उदाहरण ।
Nijvachak sarvanam , निजवाचक सर्वनाम किसे कहते हैं , परिभाषा और उदाहरण- हिंदी व्याकरण ।
Sarvanam kise kahate hain ,सर्वनाम के कितने भेद होते हैं, परिभाषा एवं इनके भेद उदाहरण के साथ ।
Sanyukt kriya , संयुक्त क्रिया के परिभाषा भेद एवं उदाहरण ।
Hindi varnamala , hindi alphabet- वर्णमाला क्या हैं परिभाषा भेद एवं उदाहरण – Hindi letters ।
Kaal ke bhed ,काल हिंदी ग्रामर परिभाषा एवं भेद ।
Kriya kise kahate hain , क्रिया के कितने भेद होते हैं, परिभाषा एवं उदाहरण ।
Akarmak and Sakarmak Kriya , ( सकर्मक अकर्मक क्रिया के उदाहरण और परिभाषा ) ,
Karak kise kahate hain,(कारक कितने प्रकार के होते हैं ,कारक की परिभाषा)
Upsarg ki paribhasha ,(उपसर्ग किसे कहते हैं यह कितने प्रकार के होते हैं )- awgrammar
Recent Posts
Recent Comments
Robots.txt Test94% of top 100 sites passed
  • Congratulations! Your site uses a "robots.txt" file.
https://awgrammar.com/robots.txt
Sitemap Test75% of top 100 sites passed
  • Congratulations! Your website has a sitemap file.
https://awgrammar.com/sitemap.xml
https://awgrammar.com/sitemap_index.xml
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All of your webpage's "img" tags have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Need to track more websites?
Get between 3 and 15 monitored websites and supercharge your SEO.
Speed optimizations
2Failed
1Warnings
17Passed
HTML Page Size Test34% of top 100 sites passed
  • Congratulations! The size of your webpage's HTML is 13.37 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,599 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 84.45 Kb to 13.37 Kb (84% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 0.63 seconds and this is under the average loading speed which is 5 seconds.
JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Congratulations, your page has fewer than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from your server, which will ultimately slow down the loading of your web page.
Content size by content type
Content type
Percent
Size
image
62.6 %
68.61 Kb
css
15.6 %
17.04 Kb
html
12.9 %
14.09 Kb
javascript
8.9 %
9.79 Kb
font
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
109.53 Kb
Requests by content type
Content type
Percent
Requests
image
38.5 %
5
javascript
30.8 %
4
css
23.1 %
3
html
7.7 %
1
font
0.0 %
0
other
0.0 %
0
TOTAL
100%
13
Content size by domain
Domain
Percent
Size
awgrammar.com
100.0 %
109.53 Kb
TOTAL
100%
109.53 Kb
Requests by domain
Domain
Percent
Requests
awgrammar.com
100.0 %
13
TOTAL
100%
13
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Caching Test99% of top 100 sites passed
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • Congratulations! Your website's JavaScript files are minified!
CSS Minification Test97% of top 100 sites passed
  • Congratulations! Your webpage's CSS resources are minified.
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
http://awgrammar.com/https://awgrammar.com/
Track up to 5 competitors 24/7
Analyze SEO metrics & get important information about your competition.
Server and security
0Failed
0Warnings
9Passed
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "awgrammar.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.awgrammar.com
Subject Alternative Names (SANs)
*.awgrammar.com, awgrammar.com
Not valid before
Tue, May 17th 2022, 10:17:30 am (UTC)
Not valid after
Mon, August 15th 2022, 10:17:29 am (UTC)
Signature algorithm
ecdsaWithSha384
Issuer
E1
Intermediate certificate
Common name
E1
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4th 2020, 12:00:00 am (UTC)
Not valid after
Mon, September 15th 2025, 4:00:00 pm (UTC)
Signature algorithm
ecdsaWithSha384
Issuer
ISRG Root X2
Intermediate certificate
Common name
ISRG Root X2
Organization
Internet Security Research Group
Location
US
Not valid before
Fri, September 4th 2020, 12:00:00 am (UTC)
Not valid after
Mon, September 15th 2025, 4:00:00 pm (UTC)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4th 2015, 11:04:38 am (UTC)
Not valid after
Mon, June 4th 2035, 11:04:38 am (UTC)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • Congratulations, your server signature is off.
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test93% of top 100 sites passed
  • Congratulations! Your webpage does not include email addresses in plaintext.
Monitor your website keywords
Get useful insights and detailed metrics for your most important keywords.
Mobile usability
0Failed
0Warnings
3Passed
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
meta name="viewport" content="width=device-width, initial-scale=1"
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Your branded PDF Report is almost ready
Wow your clients with white labeled SEO Reports.
Advanced SEO
1Failed
0Warnings
8Passed
Structured Data Test59% of top 100 sites passed
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://awgrammar.com is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://awgrammar.com/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:_spf.mail.hostinger.com ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Analyze and monitor your SEO with our powerful SEO ToolBox
Try the new features of our supercharged SEO ToolBox using a 7-day free trial account
Check your website's SEO for free right now!
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
Company
Legal
© SEO Site Checkup 2009-2022 • All rights reserved