seo site checkup logo
PricingFree ToolsArticles
Log in
Report generated 5 minutes ago
https://boardgame.id
Your general SEO Checkup Score
Archived
61/100
SEO Score
20 Failed
0 Warnings
47 Passed
Issues to fix
Last found on May 20 2022, 04:23 AM
HIGH
Some of your website's JavaScript files are not minified!
HIGH
Your webpage contains URLs that are not SEO friendly!
HIGH
Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
HIGH
Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
HIGH
The meta description tag is missing from your page. You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
HIGH
Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
HIGH
This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
HIGH
This webpage is not serving images in a modern format. Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
HIGH
Your website loading time is around 5.54 seconds and is over the average loading speed which is 5 seconds.
HIGH
Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
MEDIUM
The Document Object Model (DOM) of this webpage has 4,571 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
MEDIUM
Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on your site.
MEDIUM
Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
MEDIUM
Your website lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
MEDIUM
Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
LOW
We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
LOW
This webpage has some errors caught by the Chrome DevTools Console!
LOW
Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
LOW
Your webpage is using inline CSS styles!
Common SEO issues
11Failed
0Warnings
15Passed
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Boardgame.id | Info terbaru board game Indonesia & dunia – Info terbaru board game Indonesia & dunia
Meta Description Test97% of top 100 sites passed
  • The meta description tag is missing from your page. You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Boardgame.id | Info terbaru board game Indonesia & dunia – Info terbaru board game Indonesia & duniahttps://boardgame.id
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
HOME 2022
og:type
article
og:url
https://boardgame.id/
og:site_name
Boardgame.id | Info terbaru board game Indonesia & dunia
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
106game56board41kabar16jadi14headline
Keywords Usage Test81% of top 100 sites passed
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud Test
adeganairportanakangkasaangkatbandarabarubelajarbergiziberguguranberitaberlatarbermainbisaboardboardgamecaturcornerdalamdaundecodedicobadodoedisiescapeeventfilmfinalisfoodsfotografergambitgamegameathongamesgarapgeekshappyheadlineheninghitsindonesiaindustrijadijawabjermankabarkamikamukekaisarankeluargakenaliketikakickstarterkompetisikomunitaskreatoriakumpulkanlokallordludenaramainmakananmasukmedismenaramenumomijinoirpartypemecahpendidikanperanperfectpictureprofesionalpunyapuraqueenrancangreviewrilisringsroomsajikansalmonsaranasatyasebelumsemuaseputarshufflesiswasupertamantantangtanyaterbaruumumkanworkshopyang
Competitor Domains Test
Understand your competitors' SEO profile

Side-by-side SEO comparisons of up to 5 competitors. See how your SEO can improve against the competition.

Heading Tags Test70% of top 100 sites passed
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Headline
Kabar Terbaru
Robots.txt Test94% of top 100 sites passed
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test75% of top 100 sites passed
  • Your website lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • All of your webpage's "img" tags have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on your site.
See results list
Inline CSS Test2% of top 100 sites passed
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Need to track more websites?
Get between 3 and 15 monitored websites and supercharge your SEO.
Speed optimizations
6Failed
0Warnings
14Passed
HTML Page Size Test34% of top 100 sites passed
  • Congratulations! The size of your webpage's HTML is 13.71 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 4,571 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 143.49 Kb to 13.71 Kb (90% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 5.54 seconds and is over the average loading speed which is 5 seconds.
JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
82.2 %
3.74 Mb
font
7.5 %
351.14 Kb
javascript
5.6 %
259.91 Kb
css
4.4 %
205.60 Kb
html
0.3 %
14.26 Kb
other
0.0 %
0 B
TOTAL
100%
4.55 Mb
Requests by content type
Content type
Percent
Requests
css
39.0 %
39
javascript
38.0 %
38
image
13.0 %
13
html
6.0 %
6
font
4.0 %
4
other
0.0 %
0
TOTAL
100%
100
Content size by domain
Domain
Percent
Size
boardgame.id
98.3 %
4.47 Mb
fonts.gstatic.com
1.2 %
54.95 Kb
google-analytics.com
0.4 %
19.92 Kb
fonts.googleapis.com
0.1 %
3.00 Kb
TOTAL
100%
4.55 Mb
Requests by domain
Domain
Percent
Requests
boardgame.id
95.0 %
95
fonts.googleapis.com
2.0 %
2
fonts.gstatic.com
2.0 %
2
google-analytics.com
1.0 %
1
TOTAL
100%
100
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format. Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Caching Test99% of top 100 sites passed
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Congratulations! Your webpage's CSS resources are minified.
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Track up to 5 competitors 24/7
Analyze SEO metrics & get important information about your competition.
Server and security
1Failed
0Warnings
8Passed
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "boardgame.id" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
sni.cloudflaressl.com
Organization
Cloudflare, Inc.
Location
San Francisco, California, US
Subject Alternative Names (SANs)
*.boardgame.id, boardgame.id, sni.cloudflaressl.com
Not valid before
Wed, May 11th 2022, 12:00:00 am (UTC)
Not valid after
Wed, May 10th 2023, 11:59:59 pm (UTC)
Signature algorithm
ecdsaWithSha256
Issuer
Cloudflare Inc ECC CA-3
Intermediate certificate
Common name
Cloudflare Inc ECC CA-3
Organization
Cloudflare, Inc.
Location
US
Not valid before
Mon, January 27th 2020, 12:48:08 pm (UTC)
Not valid after
Tue, December 31st 2024, 11:59:59 pm (UTC)
Signature algorithm
sha256WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Root certificate
Common name
Baltimore CyberTrust Root
Organization
Baltimore
Location
IE
Not valid before
Fri, May 12th 2000, 6:46:00 pm (UTC)
Not valid after
Mon, May 12th 2025, 11:59:00 pm (UTC)
Signature algorithm
sha1WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • Congratulations, your server signature is off.
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Monitor your website keywords
Get useful insights and detailed metrics for your most important keywords.
Mobile usability
0Failed
0Warnings
3Passed
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
meta name="viewport" content="width=device-width, initial-scale=1"
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Your branded PDF Report is almost ready
Wow your clients with white labeled SEO Reports.
Advanced SEO
2Failed
0Warnings
7Passed
Structured Data Test59% of top 100 sites passed
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test75% of top 100 sites passed
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://boardgame.id is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://boardgame.id/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +a +mx ip4:103.23.20.234/32 ip4:103.23.20.235/32 ip4:103.43.46.210/32 ip4:103.43.47.239/32 -all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Check your website's SEO for free right now!
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2009-2022 • All rights reserved